PDB entry 1ep0

View 1ep0 on RCSB PDB site
Description: high resolution crystal structure of dtdp-6-deoxy-d-xylo-4-hexulose 3,5-epimerase from methanobacterium thermoautotrophicum
Class: isomerase
Keywords: racemase, dTDP-4-dehydrorhamnose epimerase, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, ISOMERASE
Deposited on 2000-03-24, released 2000-12-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.183
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dtdp-6-deoxy-d-xylo-4-hexulose 3,5-epimerase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ep0a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ep0A (A:)
    maefrfiktsldgaiiiepevytdergyfmetfneaifqenglevrfvqdnesmsvrgvl
    rglhfqrekpqgklvrvirgeifdvavdlrknsdtygewtgvrlsdenrreffipegfah
    gflalsdecivnykctelyhpeydsgipwddpdigidwplemvddliisekdrnwkplre
    npvyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ep0A (A:)
    efrfiktsldgaiiiepevytdergyfmetfneaifqenglevrfvqdnesmsvrgvlrg
    lhfqrekpqgklvrvirgeifdvavdlrknsdtygewtgvrlsdenrreffipegfahgf
    lalsdecivnykctelyhpeydsgipwddpdigidwplemvddliisekdrnwkplrenp
    vyl