PDB entry 1eow

View 1eow on RCSB PDB site
Description: crystal structure of ribonuclease a complexed with uridylyl(2',5')guanosine (non-productive binding)
Deposited on 2000-03-24, released 2000-11-17
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-17, with a file datestamp of 2000-11-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.187
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1eowa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eowA (A:)
  ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
  knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
  dasv