PDB entry 1eow

View 1eow on RCSB PDB site
Description: crystal structure of ribonuclease a complexed with uridylyl(2',5')guanosine (non-productive binding)
Class: hydrolase
Keywords: non-productive binding, protein-nucleotide interactions, hydrolase
Deposited on 2000-03-24, released 2000-11-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.187
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease pancreatic
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61823 (0-123)
  Domains in SCOPe 2.08: d1eowa_
• Heterogens: SO4, U2G, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eowA (A:)
  ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
  knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
  dasv