PDB entry 1eov

View 1eov on RCSB PDB site
Description: free aspartyl-tRNA synthetase (asprs) (e.c. 6.1.1.12) from yeast
Class: ligase
Keywords: aminoacyl tRNA synthetase, tRNA ligase, apo-enzyme, OB-fold, LIGASE
Deposited on 2000-03-24, released 2000-09-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.202
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ASPARTYL-tRNA SYNTHETASE
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: APS GENE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eova1, d1eova2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eovA (A:)
    akdnygklpliqsrdsdrtgqkrvkfvdldeakdsdkevlfrarvhntrqqgatlafltl
    rqqasliqglvkankegtisknmvkwagslnlesivlvrgivkkvdepiksatvqnleih
    itkiytisetpealpilledasrseaeaeaaglpvvnldtrldyrvidlrtvtnqaifri
    qagvcelfreylatkkftevhtpkllgapseggssvfevtyfkgkaylaqspqfnkqqli
    vadfervyeigpvfraensnthrhmteftgldmemafeehyhevldtlselfvfifselp
    krfaheielvrkqypveefklpkdgkmvrltykegiemlraagkeigdfedlstenekfl
    gklvrdkydtdfyildkfpleirpfytmpdpanpkysnsydffmrgeeilsgaqrihdha
    llqermkahglspedpglkdycdgfsygcpphagggiglervvmfyldlknirraslfpr
    dpkrlrp