PDB entry 1eoq

View 1eoq on RCSB PDB site
Description: rous sarcoma virus capsid protein: c-terminal domain
Class: Viral protein
Keywords: virus/viral protein
Deposited on 2000-03-23, released 2000-08-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gag polyprotein capsid protein p27
    Species: Rous sarcoma virus - Prague C [TaxId:11888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03322 (1-End)
      • initiating met (0)
    Domains in SCOPe 2.07: d1eoqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eoqA (A:)
    mdimqgpsesfvdfanrlikavegsdlppsarapviidcfrqksqpdiqqlirtapstlt
    tpgeiikyvldrqktapltdqgiaaamssaiqplim
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eoqA (A:)
    mdimqgpsesfvdfanrlikavegsdlppsarapviidcfrqksqpdiqqlirtapstlt
    tpgeiikyvldrqktap