PDB entry 1eoo

View 1eoo on RCSB PDB site
Description: ecorv bound to cognate DNA
Class: hydrolase/DNA
Keywords: protein-DNA recognition, induced fit, endonuclease, hydrolase/DNA COMPLEX
Deposited on 2000-03-23, released 2000-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: 0.231
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type II restriction enzyme EcoRV
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eooa_
  • Chain 'B':
    Compound: Type II restriction enzyme EcoRV
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eoob_
  • Chain 'C':
    Compound: DNA (5'-d(*gp*ap*ap*gp*ap*tp*ap*tp*cp*tp*tp*c)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*gp*ap*ap*gp*ap*tp*ap*tp*cp*tp*tp*c)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eooA (A:)
    mslrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhg
    yiveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkn
    ivypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdl
    agsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwi
    yrgrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eooA (A:)
    slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
    iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
    vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
    gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
    rgrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eooB (B:)
    mslrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhg
    yiveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkn
    ivypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdl
    agsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwi
    yrgrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eooB (B:)
    slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
    iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
    vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
    gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
    rgrk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.