PDB entry 1eom

View 1eom on RCSB PDB site
Description: crystal structure of the complex of endo-beta-n-acetylglucosaminidase f3 with a biantennary complex octasaccharide
Class: hydrolase
Keywords: (alpha/beta)-barrel, HYDROLASE
Deposited on 2000-03-23, released 2000-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.161
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-beta-n-acetylglucosaminidase f3
    Species: Elizabethkingia meningoseptica [TaxId:238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eoma_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eomA (A:)
    atalagsngvciayyitdgrnptfklkdipdkvdmvilfglkywslqdttklpggtgmmg
    sfksykdldtqirslqsrgikvlqnidddvswqsskpggfasaaaygdaiksividkwkl
    dgisldiehsgakpnpiptfpgyaatgyngwysgsmaatpaflnviseltkyfgttapnn
    kqlqiasgidvyawnkimenfrnnfnyiqlqsyganvsrtqlmmnyatgtnkipaskmvf
    gayaeggtnqandvevakwtptqgakggmmiytynsnvsyanavrdavkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eomA (A:)
    ngvciayyitdgrnptfklkdipdkvdmvilfglkywslqdttklpggtgmmgsfksykd
    ldtqirslqsrgikvlqnidddvswqsskpggfasaaaygdaiksividkwkldgisldi
    ehsgakpnpiptfpgyaatgyngwysgsmaatpaflnviseltkyfgttapnnkqlqias
    gidvyawnkimenfrnnfnyiqlqsyganvsrtqlmmnyatgtnkipaskmvfgayaegg
    tnqandvevakwtptqgakggmmiytynsnvsyanavrdavkn