PDB entry 1eok

View 1eok on RCSB PDB site
Description: crystal structure of endo-beta-n-acetylglucosaminidase f3
Class: hydrolase
Keywords: alpha/beta-barrel, HYDROLASE
Deposited on 2000-03-23, released 2000-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.172
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-beta-n-acetylglucosaminidase f3
    Species: Elizabethkingia meningoseptica [TaxId:238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eoka_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eokA (A:)
    atalagsngvciayyitdgrnptfklkdipdkvdmvilfglkywslqdttklpggtgmmg
    sfksykdldtqirslqsrgikvlqnidddvswqsskpggfasaaaygdaiksividkwkl
    dgisldiehsgakpnpiptfpgyaatgyngwysgsmaatpaflnviseltkyfgttapnn
    kqlqiasgidvyawnkimenfrnnfnyiqlqsyganvsrtqlmmnyatgtnkipaskmvf
    gayaeggtnqandvevakwtptqgakggmmiytynsnvsyanavrdavkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eokA (A:)
    ngvciayyitdgrnptfklkdipdkvdmvilfglkywslqdttklpggtgmmgsfksykd
    ldtqirslqsrgikvlqnidddvswqsskpggfasaaaygdaiksividkwkldgisldi
    ehsgakpnpiptfpgyaatgyngwysgsmaatpaflnviseltkyfgttapnnkqlqias
    gidvyawnkimenfrnnfnyiqlqsyganvsrtqlmmnyatgtnkipaskmvfgayaegg
    tnqandvevakwtptqgakggmmiytynsnvsyanavrdavk