PDB entry 1eoj

View 1eoj on RCSB PDB site
Description: Design of P1' and P3' residues of trivalent thrombin inhibitors and their crystal structures
Class: hydrolase/hydrolase inhibitor
Keywords: thrombin inhibitors, serine protease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2000-03-23, released 2000-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha thrombin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00734 (4-288)
      • conflict (4)
    Domains in SCOPe 2.07: d1eoja_
  • Chain 'B':
    Compound: thrombin inhibitor p798
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1EOJ (0-13)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eojA (A:)
    ggadcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspqellc
    gaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihp
    rynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketw
    tanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggp
    fvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eojA (A:)
    ggadcglrplfekksledkterellesyiivegsdaeigmspwqvmlfrkspqellcgas
    lisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpryn
    wrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlkegqpsv
    lqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvmkspfnnrw
    yqmgivswgegcdrdgkygfythvfrlkkwiqkvidqf
    

  • Chain 'B':
    No sequence available.