PDB entry 1eof

View 1eof on RCSB PDB site
Description: crystal structure of the n136a mutant of a shaker t1 domain
Deposited on 2000-03-22, released 2000-05-02
The last revision prior to the SCOP 1.59 freeze date was dated 2000-05-02, with a file datestamp of 2000-05-02.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.225
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1eofa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eofA (A:)
    ervvinvsglrfetqlktlnqfpdtllgnpqkrnryydplrneyffdrnrpsfdailyfy
    qsggrlrrpvavpldvfseeikfyelgenaferyredegf