PDB entry 1eof

View 1eof on RCSB PDB site
Description: crystal structure of the n136a mutant of a shaker t1 domain
Class: membrane protein
Keywords: potassium channels, aplysia kv1.1, proton transport, membrane protein
Deposited on 2000-03-22, released 2000-05-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: potassium channel kv1.1
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16968 (0-99)
      • engineered (70)
    Domains in SCOPe 2.08: d1eofa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eofA (A:)
    ervvinvsglrfetqlktlnqfpdtllgnpqkrnryydplrneyffdrnrpsfdailyfy
    qsggrlrrpvavpldvfseeikfyelgenaferyredegf