PDB entry 1eoe

View 1eoe on RCSB PDB site
Description: crystal structure of the v135r mutant of a shaker t1 domain
Deposited on 2000-03-22, released 2000-05-02
The last revision prior to the SCOP 1.63 freeze date was dated 2000-05-02, with a file datestamp of 2000-05-02.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.219
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.63: d1eoea_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eoeA (A:)
  ervvinvsglrfetqlktlnqfpdtllgnpqkrnryydplrneyffdrnrpsfdailyfy
  qsggrlrrprnvpldvfseeikfyelgenaferyredegf