PDB entry 1eob

View 1eob on RCSB PDB site
Description: crystal structure of acinetobacter sp. adp1 protocatechuate 3,4-dioxygenase in complex with 3,4-dihydroxybenzoate
Class: oxidoreductase
Keywords: beta-sandwich, mixed alpha/beta structure, dioxygenase, biodegradation
Deposited on 2000-03-22, released 2000-08-09
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.182
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protocatechuate 3,4-dioxygenase alpha chain
    Species: Acinetobacter sp.
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20371 (Start-208)
      • see remark 999 (63)
    Domains in SCOP 1.75: d1eoba_
  • Chain 'B':
    Compound: protocatechuate 3,4-dioxygenase beta chain
    Species: Acinetobacter sp.
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1eobb_
  • Heterogens: FE, DHB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eobA (A:)
    mngwnfqelketpsqtggpyvhigllpkqanievfehnldnnlvqdntqgqrirlegqvf
    dglglplrdvlieiwqadtngvypsqadtqgkqvdpnflgwgrtgadfgtgfwsfntikp
    gavpgrkgstqaphisliifarginiglhtrvyfddeaeanakdpvlnsiewatrrqtlv
    akreerdgevvyrfdiriqgenetvffdi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eobA (A:)
    elketpsqtggpyvhigllpkqanievfehnldnnlvqdntqgqrirlegqvfdglglpl
    rdvlieiwqadtngvypsqadtqgkqvdpnflgwgrtgadfgtgfwsfntikpgavpgrk
    gstqaphisliifarginiglhtrvyfddeaeanakdpvlnsiewatrrqtlvakreerd
    gevvyrfdiriqgenetvffdi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eobB (B:)
    msqiiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpk
    dndlilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigam
    dpnfggcgrmltddngyyvfrtikpgpypwrnrinewrpahihfsliadgwaqrlisqfy
    fegdtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendl
    t
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eobB (B:)
    iiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpkdnd
    lilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigamdpn
    fggcgrmltddngyyvfrtikpgpypwrnrinewrpahihfsliadgwaqrlisqfyfeg
    dtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendlt