PDB entry 1eo8

View 1eo8 on RCSB PDB site
Description: influenza virus hemagglutinin complexed with a neutralizing antibody
Class: Viral protein/Immune system
Keywords: COMPLEX (HEMAGGLUTININ-IMMMUNOGLOBULIN), HEMAGGLUTININ, IMMUNOGLOBULIN, VIRAL PROTEIN, IMMUNE SYSTEM COMPLEX, Viral protein-Immune system COMPLEX
Deposited on 2000-03-22, released 2000-04-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.196
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin (ha1 chain)
    Species: Influenza A virus (A/X-31(H3N2)) [TaxId:132504]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1eo8a_
  • Chain 'B':
    Compound: hemagglutinin (ha2 chain)
    Species: Influenza A virus (A/X-31(H3N2)) [TaxId:132504]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1eo8b_
  • Chain 'H':
    Compound: antibody (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB CAB76381 (0-216)
      • conflict (64)
      • conflict (191-192)
    Domains in SCOPe 2.06: d1eo8h1, d1eo8h2
  • Chain 'L':
    Compound: antibody (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB CAB76382 (0-120)
      • conflict (38)
    Domains in SCOPe 2.06: d1eo8l1, d1eo8l2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eo8A (A:)
    qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
    gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
    itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
    gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg
    dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
    tygacpkyvkqntlklatgmrnvpekqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eo8A (A:)
    statlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
    allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
    gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgihhpstn
    qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
    gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
    vkqntlklatgmrnvpekq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eo8B (B:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eo8H (H:)
    qvqlqqsgaelmkpgpsvkisckatgysfstyfiewirqrpghglewigeilpgsdntnf
    nekfkdratftadtpsntaymqlssltsedsavyycarptgrlwfsywgqgtlvtvsaak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpssprpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eo8L (L:)
    qiiltqspaimsaspgekvtmtcsassdisymhwyqqksdtspkiwiydtsklasgvpar
    fsgsgsgtsysltistmeaedaatyychqrssyptfgggtkleikradaaptvsifppsk
    iqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltlt
    kdeyerhnsytceathktstspivksfnrn