PDB entry 1eo8

View 1eo8 on RCSB PDB site
Description: influenza virus hemagglutinin complexed with a neutralizing antibody
Deposited on 2000-03-22, released 2000-04-12
The last revision prior to the SCOP 1.69 freeze date was dated 2000-11-29, with a file datestamp of 2000-11-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.196
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eo8A (A:)
    qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
    gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
    itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
    gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg
    dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
    tygacpkyvkqntlklatgmrnvpekqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eo8A (A:)
    statlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
    allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
    gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgihhpstn
    qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
    gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
    vkqntlklatgmrnvpekq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eo8B (B:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eo8H (H:)
    qvqlqqsgaelmkpgpsvkisckatgysfstyfiewirqrpghglewigeilpgsdntnf
    nekfkdratftadtpsntaymqlssltsedsavyycarptgrlwfsywgqgtlvtvsaak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpssprpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eo8L (L:)
    qiiltqspaimsaspgekvtmtcsassdisymhwyqqksdtspkiwiydtsklasgvpar
    fsgsgsgtsysltistmeaedaatyychqrssyptfgggtkleikradaaptvsifppsk
    iqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltlt
    kdeyerhnsytceathktstspivksfnrn