PDB entry 1eo6

View 1eo6 on RCSB PDB site
Description: crystal structure of gate-16
Class: protein binding
Keywords: ubiquitin fold, PROTEIN BINDING
Deposited on 2000-03-22, released 2000-09-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.229
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: golgi-associated ATPase enhancer of 16 kd
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1eo6a_
  • Chain 'B':
    Compound: golgi-associated ATPase enhancer of 16 kd
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1eo6b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eo6A (A:)
    mkwmfkedhslehrcvesakirakypdrvpvivekvsgsqivdidkrkylvpsditvaqf
    mwiirkriqlpsekaiflfvdktvpqssltmgqlyekekdedgflyvaysgentfgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eo6A (A:)
    mkwmfkedhslehrcvesakirakypdrvpvivekvsgsqivdidkrkylvpsditvaqf
    mwiirkriqlpsekaiflfvdktvpqssltmgqlyekekdedgflyvaysgentfg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eo6B (B:)
    mkwmfkedhslehrcvesakirakypdrvpvivekvsgsqivdidkrkylvpsditvaqf
    mwiirkriqlpsekaiflfvdktvpqssltmgqlyekekdedgflyvaysgentfgf