PDB entry 1eo2

View 1eo2 on RCSB PDB site
Description: crystal structure of acinetobacter sp. adp1 protocatechuate 3,4-dioxygenase
Class: oxidoreductase
Keywords: beta-sandwich, mixed alpha/beta structure, dioxygenase, biodegradation, OXIDOREDUCTASE
Deposited on 2000-03-21, released 2000-08-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.176
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protocatechuate 3,4-dioxygenase alpha chain
    Species: Acinetobacter sp. [TaxId:62977]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20371 (Start-208)
      • see remark 999 (63)
    Domains in SCOPe 2.06: d1eo2a_
  • Chain 'B':
    Compound: protocatechuate 3,4-dioxygenase beta chain
    Species: Acinetobacter sp. [TaxId:62977]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1eo2b_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eo2A (A:)
    mngwnfqelketpsqtggpyvhigllpkqanievfehnldnnlvqdntqgqrirlegqvf
    dglglplrdvlieiwqadtngvypsqadtqgkqvdpnflgwgrtgadfgtgfwsfntikp
    gavpgrkgstqaphisliifarginiglhtrvyfddeaeanakdpvlnsiewatrrqtlv
    akreerdgevvyrfdiriqgenetvffdi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eo2A (A:)
    elketpsqtggpyvhigllpkqanievfehnldnnlvqdntqgqrirlegqvfdglglpl
    rdvlieiwqadtngvypsqadtqgkqvdpnflgwgrtgadfgtgfwsfntikpgavpgrk
    gstqaphisliifarginiglhtrvyfddeaeanakdpvlnsiewatrrqtlvakreerd
    gevvyrfdiriqgenetvffdi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eo2B (B:)
    msqiiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpk
    dndlilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigam
    dpnfggcgrmltddngyyvfrtikpgpypwrnrinewrpahihfsliadgwaqrlisqfy
    fegdtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendl
    t
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eo2B (B:)
    iiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpkdnd
    lilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigamdpn
    fggcgrmltddngyyvfrtikpgpypwrnrinewrpahihfsliadgwaqrlisqfyfeg
    dtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendlt