PDB entry 1eo0

View 1eo0 on RCSB PDB site
Description: conserved domain common to transcription factors tfiis, elongin a, crsp70
Deposited on 2000-03-21, released 2000-05-03
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-03, with a file datestamp of 2000-05-03.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1eo0a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eo0A (A:)
  mdskevlvhvknleknksndaavleilhvldkefvptekllretkvgvevnkfkkstnve
  isklvkkmisswkdain