PDB entry 1eo0

View 1eo0 on RCSB PDB site
Description: conserved domain common to transcription factors TFIIS, elongin a, crsp70
Class: transcription
Keywords: helix-bundle, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, TRANSCRIPTION
Deposited on 2000-03-21, released 2000-05-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription elongation factor s-II
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1eo0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eo0A (A:)
    mdskevlvhvknleknksndaavleilhvldkefvptekllretkvgvevnkfkkstnve
    isklvkkmisswkdain