PDB entry 1enx

View 1enx on RCSB PDB site
Description: structural comparison of two major endo-1,4-beta-xylanases from trichodrema reesei
Class: hydrolase
Keywords: xylanase, hydrolase
Deposited on 1994-11-14, released 1995-08-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.193
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase II
    Species: Hypocrea jecorina [TaxId:51453]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1enxa1, d1enxa2
  • Chain 'B':
    Compound: endo-1,4-beta-xylanase II
    Species: Hypocrea jecorina [TaxId:51453]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1enxb1, d1enxb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1enxA (A:)
    etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
    nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
    qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
    ssgsasitvs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1enxB (B:)
    etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
    nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
    qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
    ssgsasitvs