PDB entry 1enw

View 1enw on RCSB PDB site
Description: elongation factor tfiis domain ii
Deposited on 2000-03-21, released 2000-04-12
The last revision prior to the SCOP 1.63 freeze date was dated 2000-05-10, with a file datestamp of 2000-05-10.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1enwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1enwA (A:)
gshmprnskndgvdtaiyhhklrdqvlkalydvlakesehppqsilhtakaiesemnkvn
ncdtneaaykaryriiysnvisknnpdlkhkiangditpeflatcdakdlapap