PDB entry 1enw

View 1enw on RCSB PDB site
Description: elongation factor TFIIS domain II
Class: transcription
Keywords: helix-bundle, TRANSCRIPTION
Deposited on 2000-03-21, released 2000-04-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: transcription elongation factor s-II
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07273 (4-113)
    • expression artifact (0-3)
  Domains in SCOPe 2.08: d1enwa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1enwA (A:)
  gshmprnskndgvdtaiyhhklrdqvlkalydvlakesehppqsilhtakaiesemnkvn
  ncdtneaaykaryriiysnvisknnpdlkhkiangditpeflatcdakdlapap