PDB entry 1env

View 1env on RCSB PDB site
Description: atomic structure of the ectodomain from hiv-1 gp41
Class: viral protein
Keywords: VIRAL FUSION, COAT PROTEIN, Viral protein
Deposited on 1997-06-27, released 1997-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 envelope protein chimera consisting of a fragment of gcn4 zipper cloned n-terminal to two fragments of gp41
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03377 (2-78)
      • engineered mutation (3)
      • engineered mutation (7)
      • engineered mutation (10)
      • engineered mutation (14)
      • engineered mutation (17)
      • engineered mutation (21)
      • engineered mutation (24)
      • engineered mutation (28)
    • Uniprot P03377 (85-122)
    Domains in SCOPe 2.07: d1enva_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1envA (A:)
    mkqiedkieeilskiyhieneiarikkligearqllsgivqqqnnllraieaqqhllqlt
    vwgikqlqarilaverylkdqnnmtwmewdreinnytslihslieesqnqqekneqelle
    ldk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1envA (A:)
    qiedkieeilskiyhieneiarikkligearqllsgivqqqnnllraieaqqhllqltvw
    gikqlqarilaverylkwmewdreinnytslihslieesqnqqekneqelleldk