PDB entry 1enu

View 1enu on RCSB PDB site
Description: A new target for shigellosis: Rational design and crystallographic studies of inhibitors of tRNA-guanine transglycosylase
Class: transferase
Keywords: tRNA-modifying enzyme, glycosyltransferase, transferase
Deposited on 2000-03-21, released 2000-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.176
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA-guanine transglycosylase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1enua_
  • Heterogens: ZN, APZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1enuA (A:)
    mveataqetdrprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvr
    atgadiilgntyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqsee
    gvtfkshldgsrhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwak
    rsrdafdsrkeqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdem
    frvldfsvpmlpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpi
    nirnarfsedlkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqk
    irdsisegrfsqfaqdfraryfarns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1enuA (A:)
    rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
    tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshldg
    srhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrk
    eqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpm
    lpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsed
    lkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrf
    sqfaqdfraryf