PDB entry 1ens

View 1ens on RCSB PDB site
Description: crystals of demetallized concanavalin a soaked with cobalt having a cobalt ion bound in the s1 site
Class: plant lectin (agglutinin)
Keywords: concanavalin a, cobalt, plant lectin, agglutinin, plant lectin (agglutinin)
Deposited on 1996-03-20, released 1996-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.207
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: concanavalin a
    Species: Canavalia ensiformis [TaxId:3823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02866 (118-236)
      • conflict (150)
      • conflict (154)
    Domains in SCOPe 2.07: d1ensa_
  • Chain 'B':
    Compound: concanavalin a
    Species: Canavalia ensiformis [TaxId:3823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02866 (118-236)
      • conflict (150)
      • conflict (154)
    Domains in SCOPe 2.07: d1ensb_
  • Heterogens: CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ensA (A:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
    lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
    iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ensA (A:)
    adtivaveldtypnyphigidiksvrskktakwnmqngkvgtahiiynsvdkrlsavvsy
    pnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnsthetnalh
    fmfnqfskdqkdlilqgdattgtdgnleltrvssgssvgralfyapvhiwessavvasfe
    atftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ensB (B:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
    lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
    iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ensB (B:)
    adtivaveldtypntsyphigidiksvrskktakwnmqngkvgtahiiynsvdkrlsavv
    sypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnsthetna
    lhfmfnqfskdqkdlilqgdattgtdgnleltrvsssvgralfyapvhiwessavvasfe
    atftflikspdshpadgiaffisnidssipsgstgrllglfpdan