PDB entry 1enr

View 1enr on RCSB PDB site
Description: co-crystals of demetallized concanavalin a with zinc and calcium having a zinc ion bound in the s1 site and a calcium ion bound in the s2 site
Class: plant lectin (agglutinin)
Keywords: concanavalin a, plant lectin, agglutinin, plant lectin (agglutinin)
Deposited on 1996-03-20, released 1996-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.176
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: concanavalin a
    Species: Canavalia ensiformis [TaxId:3823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02866 (118-236)
      • conflict (150)
      • conflict (154)
    Domains in SCOPe 2.07: d1enra_
  • Heterogens: CA, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1enrA (A:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
    lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
    iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan