PDB entry 1enp

View 1enp on RCSB PDB site
Description: brassica napus enoyl acp reductase/nadh binary complex at ph 8.0 and room temperature
Deposited on 1995-10-18, released 1996-10-14
The last revision prior to the SCOP 1.55 freeze date was dated 1996-10-14, with a file datestamp of 1996-10-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.132
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1enp__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1enp_ (-)
    lpidlrgkrafiagiaddngygwavakslaaagaeilvgtwvpalnifetslrrgkfdqs
    rvlpdgslmeikkvypldavfdnpedvpedvkankryagssnwtvqeaaecvrqdfgsid
    ilvhslangpevskplletsrkgylaaisassysfvsllshflpimnpggasisltyias
    eriipgygggmssakaalesdtrvlafeagrkqnirvntisagplgsraakaigfidtmi
    eysynnapiqktltadevgnaaaflvsplasaitgatiyvdnglnsmgvaldspvfk