PDB entry 1enp

View 1enp on RCSB PDB site
Description: brassica napus enoyl acp reductase/nadh binary complex at ph 8.0 and room temperature
Class: oxidoreductase
Keywords: oxidoreductase, plant lipid biosynthesis
Deposited on 1995-10-18, released 1996-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.132
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl acyl carrier protein reductase
    Species: Brassica napus [TaxId:3708]
    Gene: PEAR7 CLONE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1enpa_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1enpA (A:)
    sesseskassglpidlrgkrafiagiaddngygwavakslaaagaeilvgtwvpalnife
    tslrrgkfdqsrvlpdgslmeikkvypldavfdnpedvpedvkankryagssnwtvqeaa
    ecvrqdfgsidilvhslangpevskplletsrkgylaaisassysfvsllshflpimnpg
    gasisltyiaseriipgygggmssakaalesdtrvlafeagrkqnirvntisagplgsra
    akaigfidtmieysynnapiqktltadevgnaaaflvsplasaitgatiyvdnglnsmgv
    aldspvfkdldk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1enpA (A:)
    lpidlrgkrafiagiaddngygwavakslaaagaeilvgtwvpalnifetslrrgkfdqs
    rvlpdgslmeikkvypldavfdnpedvpedvkankryagssnwtvqeaaecvrqdfgsid
    ilvhslangpevskplletsrkgylaaisassysfvsllshflpimnpggasisltyias
    eriipgygggmssakaalesdtrvlafeagrkqnirvntisagplgsraakaigfidtmi
    eysynnapiqktltadevgnaaaflvsplasaitgatiyvdnglnsmgvaldspvfk