PDB entry 1enl

View 1enl on RCSB PDB site
Description: crystal structure of enolase indicates that enolase and pyruvate kinase evolved from a common ancestor
Deposited on 1988-03-23, released 1988-04-16
The last revision was dated 1989-07-12, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >1enl_ (-)
    avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
    vlhavknvndviapafvkanidvsdqkavddflisldgtanksklganailgvslaasra
    aaaeknvplykhladlsksktspyvlpvpflnvlnggshaggalalqefmiaptgaktfa
    ealrigsevyhnlksltkkrygasagnvgdeggvapniqtaeealdlivdaikaaghdgk
    vkigldcasseffkdgkydldfknpnsdkskwltgpqladlyhslmkrypivsiedpfae
    ddweawshffktagiqivaddktvtnpkriataiekkaadalllkvnqigtlsesikaaq
    dsfaagwgvmvshrsgetedtfiadlvvglrtgqiktgaparserlaklnqllrieeelg
    nnavfagenfhhgdkl
    

  • Chain 'p':
    No sequence available.