PDB entry 1enk

View 1enk on RCSB PDB site
Description: crystal structure of a pyrimidine dimer specific excision repair enzyme from bacteriophage t4: refinement at 1.45 angstroms and x-ray analysis of the three active site mutants
Class: endonuclease
Keywords: endonuclease
Deposited on 1994-08-08, released 1994-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endonuclease v
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04418 (Start-137)
      • conflict (22)
    Domains in SCOPe 2.07: d1enka_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1enkA (A:)
    mtrinltlvseladqhlmaeyrdlprvfgavrkhvangkrvrdfkisptfilgaghvtff
    ydkleflrkrqieliaeclkrgfnikdttvqdisdipqefrgdyipheasiaisqarlde
    kiaqrptwykyygkaiya
    

    Sequence, based on observed residues (ATOM records): (download)
    >1enkA (A:)
    trinltlvseladqhlmaeyrdlprvfgavrkhvangkrvrdfkisptfilgaghvtffy
    dkleflrkrqieliaeclkrgfnikdttvqdisdipqefrgdyipheasiaisqarldek
    iaqrptwykyygkaiya