PDB entry 1enh

View 1enh on RCSB PDB site
Description: structural studies of the engrailed homeodomain
Class: DNA-binding protein
Keywords: DNA-binding protein
Deposited on 1994-05-20, released 1994-08-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.197
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: engrailed homeodomain
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1enha_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1enhA (A:)
    rprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnkraki