PDB entry 1enh

View 1enh on RCSB PDB site
Description: structural studies of the engrailed homeodomain
Deposited on 1994-05-20, released 1994-08-31
The last revision prior to the SCOP 1.57 freeze date was dated 1994-08-31, with a file datestamp of 1994-09-15.
Experiment type: -
Resolution: 2.1 Å
R-factor: 0.197
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1enh__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1enh_ (-)
    rprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnkraki