PDB entry 1eng

View 1eng on RCSB PDB site
Description: structure and function of endoglucanase v
Deposited on 1993-03-25, released 1994-11-01
The last revision was dated 1994-11-01, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.154
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence, based on SEQRES records:
    >1eng_ (-)
    adgrstrywdcckpscgwakkapvnqpvfscnanfqritdfdaksgcepggvayscadqt
    pwavnddfalgfaatsiagsneagwccacyeltftsgpvagkkmvvqststggdlgsnhf
    dlnipgggvgifdgctpqfgglpgqryggissrnecdrfpdalkpgcywrfdwfknadnp
    sfsfrqvqcpaelvartgcrrnddgnfpavqip
    

    Sequence, based on observed residues (ATOM records):
    >1eng_ (-)
    adgrstrywdcckpscgwakkapvnqpvfscnanfqritdfdaksgcepggvayscadqt
    pwavnddfalgfaatsiagsneagwccacyeltftsgpvagkkmvvqststgsnhfdlni
    pgggvgifdgctpqfgglpgqryggissrnecdrfpdalkpgcywrfdwfknadnpsfsf
    rqvqcpaelvartgcrrnddgnfpavqip
    

  • Chain 'p':
    No sequence available.