PDB entry 1end

View 1end on RCSB PDB site
Description: x-ray structure of t4 endonuclease v: an excision repair enzyme specific for a pyrimidine dimer
Deposited on 1992-06-15, released 1993-10-31
The last revision was dated 1994-10-15, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.196
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >1end_ (-)
trinltlvseladqhlmaeyrelprvfgavrkhvangkrvrdfkisptfilgaghvtffy
dkleflrkrqieliaeclkrgfnikdttvqdisdipqefrgdyipheasiaisqarldek
iaqrptwykyygkaiya

  • Chain 'p':
    No sequence available.