PDB entry 1enc

View 1enc on RCSB PDB site
Description: crystal structures of the binary ca2+ and pdtp complexes and the ternary complex of the asp 21->glu mutant of staphylococcal nuclease. implications for catalysis and ligand binding
Class: hydrolase(phosphoric diester)
Keywords: hydrolase(phosphoric diester)
Deposited on 1994-02-14, released 1994-05-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.174
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: staphylococcal nuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • conflict (20)
    Domains in SCOPe 2.05: d1enca_
  • Heterogens: CA, THP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1encA (A:)
atstkklhkepatlikaidgetvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
ftkkmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnnt
heqhlrkseaqakkeklniwsednadsgq

    Sequence, based on observed residues (ATOM records): (download) 
    >1encA (A:)
lhkepatlikaidgetvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkmv
enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhlr
kseaqakkeklniws