PDB entry 1en7

View 1en7 on RCSB PDB site
Description: endonuclease vii (endovii) from phage t4
Class: hydrolase
Keywords: endonuclease, resolvase, holliday junction, DNAse, hydrolase
Deposited on 1999-02-07, released 2000-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.239
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: recombination endonuclease vii
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: GP49
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1en7a1, d1en7a2
  • Chain 'B':
    Compound: recombination endonuclease vii
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: GP49
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1en7b1, d1en7b2
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1en7A (A:)
    mlltgklykeekqkfydaqngkclicqrelnpdvqanhldhdhelngpkagkvrgllcnl
    cnaaegqmkhkfnrsglkgqgvdylewlenlltylksdytqnnihpnfvgdkskefsrlg
    keemmaemlqrgfeynesdtktqliasfkkqlrkslk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1en7B (B:)
    mlltgklykeekqkfydaqngkclicqrelnpdvqanhldhdhelngpkagkvrgllcnl
    cnaaegqmkhkfnrsglkgqgvdylewlenlltylksdytqnnihpnfvgdkskefsrlg
    keemmaemlqrgfeynesdtktqliasfkkqlrkslk