PDB entry 1en4

View 1en4 on RCSB PDB site
Description: crystal structure analysis of the e. coli manganese superoxide dismutase q146h mutant
Class: oxidoreductase
Keywords: proton shuttle, Q146H, mutant, manganese superoxide dismutase, OXIDOREDUCTASE
Deposited on 2000-03-20, released 2001-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: manganese superoxide dismutase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00448 (0-204)
      • engineered (145)
    Domains in SCOPe 2.07: d1en4a1, d1en4a2
  • Chain 'B':
    Compound: manganese superoxide dismutase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00448 (0-204)
      • engineered (145)
    Domains in SCOPe 2.07: d1en4b1, d1en4b2
  • Chain 'C':
    Compound: manganese superoxide dismutase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00448 (0-204)
      • engineered (145)
    Domains in SCOPe 2.07: d1en4c1, d1en4c2
  • Chain 'D':
    Compound: manganese superoxide dismutase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00448 (0-204)
      • engineered (145)
    Domains in SCOPe 2.07: d1en4d1, d1en4d2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1en4A (A:)
    sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
    dqlpadkktvlrnnagghanhslfwkglkkgttlqgdlkaaierdfgsvdnfkaefekaa
    asrfgsgwawlvlkgdklavvstanhdsplmgeaisgasgfpimgldvwehayylkfqnr
    rpdyikefwnvvnwdeaaarfaakk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1en4B (B:)
    sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
    dqlpadkktvlrnnagghanhslfwkglkkgttlqgdlkaaierdfgsvdnfkaefekaa
    asrfgsgwawlvlkgdklavvstanhdsplmgeaisgasgfpimgldvwehayylkfqnr
    rpdyikefwnvvnwdeaaarfaakk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1en4C (C:)
    sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
    dqlpadkktvlrnnagghanhslfwkglkkgttlqgdlkaaierdfgsvdnfkaefekaa
    asrfgsgwawlvlkgdklavvstanhdsplmgeaisgasgfpimgldvwehayylkfqnr
    rpdyikefwnvvnwdeaaarfaakk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1en4D (D:)
    sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
    dqlpadkktvlrnnagghanhslfwkglkkgttlqgdlkaaierdfgsvdnfkaefekaa
    asrfgsgwawlvlkgdklavvstanhdsplmgeaisgasgfpimgldvwehayylkfqnr
    rpdyikefwnvvnwdeaaarfaakk