PDB entry 1en2

View 1en2 on RCSB PDB site
Description: uda tetrasaccharide complex. crystal structure of urtica dioica agglutinin, a superantigen presented by mhc molecules of class i and class ii
Deposited on 2000-03-20, released 2000-06-21
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-21, with a file datestamp of 2000-06-21.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.198
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1en2a1, d1en2a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1en2A (A:)
  ercgsqggggtcpalwccsiwgwcgdsepycgrtcenkcwsgersdhrcgaavgnppcgq
  drccsvhgwcgggndycsgskcqyrc