PDB entry 1en2

View 1en2 on RCSB PDB site
Description: uda tetrasaccharide complex. crystal structure of urtica dioica agglutinin, a superantigen presented by MHC molecules of class I and class II
Class: sugar binding protein
Keywords: lectin, hevein domain, uda, superantigen, saccharide binding, sugar binding protein
Deposited on 2000-03-20, released 2000-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.198
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: agglutinin isolectin I/agglutinin isolectin v/ agglutinin isolectin vi
    Species: Urtica dioica [TaxId:3501]
    Database cross-references and differences (RAF-indexed):
    • GB AAD03614 (0-End)
      • conflict (0)
      • microheterogeneity (9)
      • microheterogeneity (13)
      • microheterogeneity (15)
      • microheterogeneity (79-80)
    Domains in SCOPe 2.07: d1en2a1, d1en2a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1en2A (A:)
    ercgsqgggstcpglrccsiwgwcgdsepycgrtcenkcwsgersdhrcgaavgnppcgq
    drccsvhgwcgggndycsggncqyrcsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1en2A (A:)
    ercgsqgggstcpglrccsiwgwcgdsepycgrtcenkcwsgersdhrcgaavgnppcgq
    drccsvhgwcgggndycsggncqyrc