PDB entry 1emy

View 1emy on RCSB PDB site
Description: crystal structure of asian elephant (elephas maximus) cyano-met myoglobin at 1.78 angstroms resolution. phe 29 (b10) accounts for its unusual ligand binding properties
Deposited on 1995-02-22, released 1995-04-20
The last revision prior to the SCOP 1.67 freeze date was dated 1995-04-20, with a file datestamp of 1995-04-27.
Experiment type: -
Resolution: 1.78 Å
R-factor: 0.153
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.67: d1emy__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1emy_ (-)
  glsdgewelvlktwgkveadipghgetvfvrlftghpetlekfdkfkhlktegemkased
  lkkqgvtvltalggilkkkghheaeiqplaqshatkhkipikylefisdaiihvlqskhp
  aefgadaqgamkkalelfrndiaakykelgfqg