PDB entry 1emy

View 1emy on RCSB PDB site
Description: crystal structure of asian elephant (elephas maximus) cyano-met myoglobin at 1.78 angstroms resolution. phe 29 (b10) accounts for its unusual ligand binding properties
Class: oxygen transport
Keywords: heme protein, globin fold, oxygen transport
Deposited on 1995-02-22, released 1995-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.153
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Elephas maximus [TaxId:9783]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1emya_
  • Heterogens: CYN, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1emyA (A:)
    glsdgewelvlktwgkveadipghgetvfvrlftghpetlekfdkfkhlktegemkased
    lkkqgvtvltalggilkkkghheaeiqplaqshatkhkipikylefisdaiihvlqskhp
    aefgadaqgamkkalelfrndiaakykelgfqg