PDB entry 1emx

View 1emx on RCSB PDB site
Description: solution structure of hptx2, a toxin from heteropoda venatoria spider venom that blocks kv4.2 potassium channel
Class: toxin
Keywords: toxin
Deposited on 2000-03-20, released 2001-01-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: heteropodatoxin 2
  Species: Heteropoda venatoria [TaxId:152925]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P58426 (0-29)
  Domains in SCOPe 2.08: d1emxa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1emxA (A:)
  ddcgklfsgcdtnadccegyvcrlwckldw