PDB entry 1emx

View 1emx on RCSB PDB site
Description: solution structure of hptx2, a toxin from heteropoda venatoria spider venom that blocks kv4.2 potassium channel
Class: toxin
Keywords: toxin
Deposited on 2000-03-20, released 2001-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heteropodatoxin 2
    Species: Heteropoda venatoria [TaxId:152925]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1emxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1emxA (A:)
    ddcgklfsgcdtnadccegyvcrlwckldw