PDB entry 1emw

View 1emw on RCSB PDB site
Description: solution structure of the ribosomal protein s16 from thermus thermophilus
Class: ribosome
Keywords: mixed alpha/beta protein
Deposited on 2000-03-20, released 2000-08-09
The last revision prior to the SCOP 1.73 freeze date was dated 2000-08-09, with a file datestamp of 2007-06-04.
Experiment type: NMR47
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s16 ribosomal protein
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80379 (0-66)
      • conflict (4-6)
      • conflict (23)
      • conflict (30)
      • see remark 999 (67-87)
    Domains in SCOP 1.73: d1emwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1emwA (A:)
    mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
    svgaqptdtarrllrqagvfrqearega