PDB entry 1emw

View 1emw on RCSB PDB site
Description: solution structure of the ribosomal protein s16 from thermus thermophilus
Class: ribosome
Keywords: mixed alpha/beta protein, ribosome
Deposited on 2000-03-20, released 2000-08-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: s16 ribosomal protein
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P80379 (0-66)
    • conflict (4-6)
    • conflict (23)
    • conflict (30)
    • see remark 999 (67-87)
  Domains in SCOPe 2.08: d1emwa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1emwA (A:)
  mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
  svgaqptdtarrllrqagvfrqearega