PDB entry 1emu

View 1emu on RCSB PDB site
Description: structure of the axin rgs-homologous domain in complex with a samp repeat from apc
Deposited on 2000-03-17, released 2000-07-05
The last revision prior to the SCOP 1.55 freeze date was dated 2000-07-05, with a file datestamp of 2000-07-05.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.205
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1emua_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1emuA (A:)
  ppylkwaeslhsllddqdgislfrtflkqegcadlldfwfactgfrklepcdsneekrlk
  laraiyrkyildnngivsrqtkpatksfikgcimkqlidpamfdqaqteiqatmeentyp
  sflksdiyleyt