PDB entry 1emt

View 1emt on RCSB PDB site
Description: fab antibody fragment of an c60 antifullerene antibody
Class: immune system
Keywords: anti-fullerene antibody, nanotubes, IMMUNE SYSTEM
Deposited on 2000-03-17, released 2000-11-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.18
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg antibody (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1EMT (0-212)
    Domains in SCOPe 2.03: d1emth1, d1emth2
  • Chain 'L':
    Compound: igg antibody (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1EMT (0-213)
    Domains in SCOPe 2.03: d1emtl1, d1emtl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1emtH (H:)
    qvhlqesgpelvrpgasvkiscktsgyvfssswmnwvkqrpgqglkwigriypgngntny
    nekfkgkatltadkssntaymqlssltsvdsavyfcatssaywgqgtlltvsaakttpps
    vyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
    vtvpssprpsetvtcnvahpasstkvdkkivpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1emtH (H:)
    qvhlqesgpelvrpgasvkiscktsgyvfssswmnwvkqrpgqglkwigriypgngntny
    nekfkgkatltadkssntaymqlssltsvdsavyfcatssaywgqgtlltvsaakttpps
    vyplapgnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtvps
    sprpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1emtL (L:)
    diqmtqttsslsaslgdrvtfscsasqdisnylnwyqqkpdgtiklliyytsslrsgvps
    rfsgsgsgtdysltinnlepediatyfcqqysrlpftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec