PDB entry 1ems

View 1ems on RCSB PDB site
Description: crystal structure of the c. elegans nitfhit protein
Deposited on 2000-03-17, released 2000-07-20
The last revision prior to the SCOP 1.59 freeze date was dated 2000-07-20, with a file datestamp of 2000-07-20.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.19
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1emsA (A:)
    matgrhfiavcqmtsdndleknfqaaknmieragekkcemvflpecfdfiglnkneqidl
    amatdceymekyrelarkhniwlslgglhhkdpsdaahpwnthliidsdgvtraeynklh
    lfdleipgkvrlmesefskagtemippvdtpigrlglsicydvrfpelslwnrkrgaqll
    sfpsaftlntglahwetllraraienqcyvvaaaqtgahnpkrqsyghsmvvdpwgavva
    qcservdmcfaeidlsyvdtlremqpvfshrrsdlytlhinekssetgglkfarfnipad
    hifystphsfvfvnlkpvtdghvlvspkrvvprltdltdaetadlfivakkvqamlekhh
    nvtstticvqdgkdagqtvphvhihilprragdfgdneiyqklashdkeperkprsneqm
    aeeavvyrnlm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1emsA (A:)
    matgrhfiavcqmtsdndleknfqaaknmieragekkcemvflpecfdfiglnkneqidl
    amatdceymekyrelarkhniwlslgglhhkdpsdaahpwnthliidsdgvtraeynklh
    lfdleipgkvrlmesefskagtemippvdtpigrlglsicydvrfpelslwnrkrgaqll
    sfpsaftlntglahwetllraraienqcyvvaaaqtgahnpkrqsyghsmvvdpwgavva
    qcservdmcfaeidlsyvdtlremqpvfshrrsdlytlhinekssetgglkfarfnipad
    hifystphsfvfvnlkpvtdghvlvspkrvvprltdltdaetadlfivakkvqamlekhh
    nvtstticvqdgkdagqtvphvhihilprragdfprsneqmaeeavvyrnlm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1emsB (B:)
    matgrhfiavcqmtsdndleknfqaaknmieragekkcemvflpecfdfiglnkneqidl
    amatdceymekyrelarkhniwlslgglhhkdpsdaahpwnthliidsdgvtraeynklh
    lfdleipgkvrlmesefskagtemippvdtpigrlglsicydvrfpelslwnrkrgaqll
    sfpsaftlntglahwetllraraienqcyvvaaaqtgahnpkrqsyghsmvvdpwgavva
    qcservdmcfaeidlsyvdtlremqpvfshrrsdlytlhinekssetgglkfarfnipad
    hifystphsfvfvnlkpvtdghvlvspkrvvprltdltdaetadlfivakkvqamlekhh
    nvtstticvqdgkdagqtvphvhihilprragdfgdneiyqklashdkeperkprsneqm
    aeeavvyrnlm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1emsB (B:)
    matgrhfiavcqmtsdndleknfqaaknmieragekkcemvflpecfdfiglnkneqidl
    amatdceymekyrelarkhniwlslgglhhkdpsdaahpwnthliidsdgvtraeynklh
    lfdleipgkvrlmesefskagtemippvdtpigrlglsicydvrfpelslwnrkrgaqll
    sfpsaftlntglahwetllraraienqcyvvaaaqtgahnpkrqsyghsmvvdpwgavva
    qcservdmcfaeidlsyvdtlremqpvfshrrsdlytlhinekssetgglkfarfnipad
    hifystphsfvfvnlkpvtdghvlvspkrvvprltdltdaetadlfivakkvqamlekhh
    nvtstticvqdgkdagqtvphvhihilprragdrsneqmaeeavvyrnlm