PDB entry 1emr

View 1emr on RCSB PDB site
Description: crystal structure of human leukemia inhibitory factor (lif)
Class: gene regulation
Keywords: 4-helix bundle, GENE REGULATION
Deposited on 2000-03-17, released 2001-03-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.191
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: leukemia inhibitory factor
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P15018 (0-158)
    • conflict (35)
    • conflict (150)
    • conflict (152)
  Domains in SCOPe 2.08: d1emra_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1emrA (A:)
  lmnqirsqlaqlngsanalfilyytaqgepfpnnleklcgpnvtdfppfhangtekaklv
  elyrivvylgtslgnitrdqkilnpsalslhsklnatadilrgllsnvlcrlcskyhvgh
  vdvtygpdtsgkdvfqkkklgcqllgkykqvisvlaqaf