PDB entry 1emn

View 1emn on RCSB PDB site
Description: nmr study of a pair of fibrillin ca2+ binding epidermal growth factor-like domains, minimized average structure
Class: matrix protein
Keywords: extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, egf-like domain, human fibrillin-1 fragment, matrix protein
Deposited on 1996-08-05, released 1996-12-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibrillin
    Species: Homo sapiens [TaxId:9606]
    Gene: FBN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35555 (0-81)
      • conflict (34)
    Domains in SCOPe 2.08: d1emna1, d1emna2
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1emnA (A:)
    savdmdeckepdvckhgqcintdgsyrcecpfgyilagnecvdtdecsvgnpcgngtckn
    viggfectceegfepgpmmtce