PDB entry 1eml

View 1eml on RCSB PDB site
Description: green fluorescent protein from aequorea victoria, mutant
Deposited on 1997-03-31, released 1997-08-20
The last revision prior to the SCOP 1.55 freeze date was dated 1997-08-20, with a file datestamp of 1997-08-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.201
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1eml__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1eml_ (-)
    lftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvttlxv
    qcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnrielkgi
    dfkedgnilghkleynynshnvyimadkqkngikvnfktrhniedgsvqladhyqqntpi
    gdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eml_ (-)
    lftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvttlvq
    cfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnrielkgid
    fkedgnilghkleynynshnvyimadkqkngikvnfktrhniedgsvqladhyqqntpig
    dgpvllpdnhylstqsalskdpnekrdhmvllefvtaagi